| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NIK/MAP3K14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NIK/MAP3K14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NIK/MAP3K14. This antibody reacts with human. The NIK/MAP3K14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVYKLEAVEKSPVFCGKWEILNDVITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNVAHA |
|---|
| Other Names | EC 2.7.11.25, FTDCR1B, HS, HsNIK, HSNIKserine/threonine protein-kinase, mitogen-activated protein kinase kinase kinase 14, NIKNF-kappa-beta-inducing kinase, Serine/threonine-protein kinase NIK |
|---|
| Gene, Accession # | MAP3K14, Gene ID: 9020 |
|---|
| Catalog # | NBP1-83414 |
|---|
| Price | |
|---|
| Order / More Info | NIK/MAP3K14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|