| Edit |   |
|---|
| Antigenic Specificity | Storkhead Box 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Storkhead Box 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Storkhead Box 2. This antibody reacts with human. The Storkhead Box 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Storkhead Box 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK |
|---|
| Other Names | KIAA1392, Storkhead-Box Protein 2, STOX2, STOX-2 |
|---|
| Gene, Accession # | STOX2, Gene ID: 56977, Accession: Q9P2F5, SwissProt: Q9P2F5 |
|---|
| Catalog # | NBP2-30480 |
|---|
| Price | |
|---|
| Order / More Info | Storkhead Box 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|