| Edit |   |
|---|
| Antigenic Specificity | EFCAB11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EFCAB11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EFCAB11. This antibody reacts with human. The EFCAB11 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human EFCAB11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS |
|---|
| Other Names | C14orf143, chromosome 14 open reading frame 143, DKFZp547I1415, EF-hand calcium binding domain 11, EF-hand domain-containing protein C14orf143, FLJ51529 |
|---|
| Gene, Accession # | EFCAB11, Gene ID: 90141 |
|---|
| Catalog # | NBP2-56193 |
|---|
| Price | |
|---|
| Order / More Info | EFCAB11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|