| Edit |   |
| Antigenic Specificity | EFCAB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EFCAB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EFCAB3. This antibody reacts with human. The EFCAB3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to EFCAB3 (EF-hand calcium binding domain 3) The peptide sequence was selected from the N terminal of EFCAB3. Peptide sequence MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA. |
| Other Names | EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827 |
| Gene, Accession # | EFCAB3, Gene ID: 146779, Accession: Q8N7B9, SwissProt: Q8N7B9 |
| Catalog # | NBP1-57043 |
| Price | |
| Order / More Info | EFCAB3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |