| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Serpin B3/SCCA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Serpin B3/SCCA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Serpin B3/SCCA1. This antibody reacts with human. The Serpin B3/SCCA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Serpin B3/SCCA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK |
|---|
| Other Names | HsT1196, Protein T4-A, SCC, SCCA, SCCA1SCCA-1, SCCA-PD, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin B3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4-A |
|---|
| Gene, Accession # | SERPINB3, Gene ID: 6317, Accession: P48594 |
|---|
| Catalog # | NBP2-46829 |
|---|
| Price | |
|---|
| Order / More Info | Serpin B3/SCCA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|