| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAF1. This antibody reacts with human. The PAF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PAF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDE EGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY |
|---|
| Other Names | F23149_1, FLJ11123, Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae), Pancreatic differentiation protein 2, PD2hPAF1, RNA polymerase II-associated factor 1 homolog |
|---|
| Gene, Accession # | PAF1, Gene ID: 54623 |
|---|
| Catalog # | NBP2-13724 |
|---|
| Price | |
|---|
| Order / More Info | PAF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|