| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD79B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD79B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD79B. This antibody reacts with human. The CD79B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CD79B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
|---|
| Other Names | B29B-cell-specific glycoprotein B29, B-cell antigen receptor complex-associated protein beta chain, CD79b antigen, CD79B antigen (immunoglobulin-associated beta), CD79b molecule, immunoglobulin-associated beta, IGBAGM6, Ig-beta, Immunoglobulin-associated B29 protein |
|---|
| Gene, Accession # | CD79B, Gene ID: 974 |
|---|
| Catalog # | NBP1-88945 |
|---|
| Price | |
|---|
| Order / More Info | CD79B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|