| Edit |   |
|---|
| Antigenic Specificity | Ferredoxin Reductase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ferredoxin Reductase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ferredoxin Reductase. This antibody reacts with human. The Ferredoxin Reductase Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FDXR(ferredoxin reductase) The peptide sequence was selected from the middle region of FDXR. Peptide sequence LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW. |
|---|
| Other Names | Adrenodoxin reductase, ADXREC 1.18.1.2, ferredoxin reductaseAR, Ferredoxin--NADP(+) reductase, NADPH:adrenodoxin oxidoreductase, mitochondrial |
|---|
| Gene, Accession # | FDXR, Gene ID: 2232, Accession: P22570, SwissProt: P22570 |
|---|
| Catalog # | NBP1-54789-20ul |
|---|
| Price | |
|---|
| Order / More Info | Ferredoxin Reductase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|