| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AKR7A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AKR7A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKR7A2. This antibody reacts with human. The AKR7A2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human AKR7A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQ |
|---|
| Other Names | AFAR1, AFARAFB1-AR1, AFB1 aldehyde reductase 1, AFB1-AR 1, aflatoxin B1 aldehyde reductase member 2, aflatoxin beta1 aldehyde reductase, AKR7, aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), Aldoketoreductase 7, EC 1.1.1.n11, SSA reductase, Succinic semialdehyde reductase |
|---|
| Gene, Accession # | AKR7A2, Gene ID: 8574 |
|---|
| Catalog # | NBP2-56509 |
|---|
| Price | |
|---|
| Order / More Info | AKR7A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|