| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACOT11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACOT11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOT11. This antibody reacts with human. The ACOT11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACOT11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE |
|---|
| Other Names | Acyl-CoA thioester hydrolase 11, acyl-CoA thioesterase 11BFIT1, Adipose-associated thioesterase, BFIT2, BFITDKFZp667O1916, Brown fat-inducible thioesterase, EC 3.1.2.-, EC 3.1.2.1, KIAA0707acyl-coenzyme A thioesterase 11, STARD14, START domain containing 14, THEAStAR-related lipid transfer (START) domain containing 14, THEM1, thioesterase superfamily member 1, thioesterase, adipose associated |
|---|
| Gene, Accession # | ACOT11, Gene ID: 26027 |
|---|
| Catalog # | NBP2-58936 |
|---|
| Price | |
|---|
| Order / More Info | ACOT11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|