| 产品详情 |
| Edit |   |
|---|
| Product Name | BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L) |
|---|
| Description | Purified (~37%). This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa29-471 from human Bromodomain containing 3, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.2kD AA Sequence: MHHHHHHPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIK NPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQK VAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQ TPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPT TSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQHAGKKGKLS EHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMD GREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitor |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | n/a |
|---|
| Gene, Accession, CAS # | Accession: NM_007371, SwissProt: Q15059 |
|---|
| Catalog # | 298353 |
|---|
| Price | |
|---|
| Order / More Info | BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|