| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 13, Member C (FAM13C) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown. |
|---|
| Immunogen | FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD |
|---|
| Other Names | FAM13C1|Fam13c1|RGD1310149|1200015N20Rik|C030038O19Rik|mKIAA1796 |
|---|
| Gene, Accession # | Gene ID: 220965 |
|---|
| Catalog # | ABIN632036 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 13, Member C (FAM13C) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|