| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ERManI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ERManI Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERManI. This antibody reacts with human. The ERManI Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ERManI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTG DRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP |
|---|
| Other Names | alpha 1,2-mannosidase, EC 3.2.1.113, endoplasmic reticulum alpha-mannosidase 1, endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase 1, ER alpha 1,2-mannosidase, ER alpha-1,2-mannosidase, ER ManI, ER mannosidase 1, ERMan1, Man9GlcNAc2-specific processing alpha-mannosidase, Man9GlcNAc2-specific-processing alpha-mannosidase, MANA-ER, Mannosidase alpha class 1B member 1, mannosidase, alpha, class 1B, member 1, MRT15, RP11-350O14.2 |
|---|
| Gene, Accession # | MAN1B1, Gene ID: 11253 |
|---|
| Catalog # | NBP2-14216 |
|---|
| Price | |
|---|
| Order / More Info | ERManI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|