| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-1,3-Glucuronyltransferase 3/B3GAT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-1,3-Glucuronyltransferase 3/B3GAT3. This antibody reacts with human. The beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to B3GAT3 (beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I)) The peptide sequence was selected from the N terminal of B3GAT3)(50ug). Peptide sequence PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYV |
|---|
| Other Names | Beta-1,3-glucuronyltransferase 3, beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3, GlcAT-I, GLCATI, GlcUAT-I, Glucuronosyltransferase I, Sqv-8-like protein, UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase |
|---|
| Gene, Accession # | B3GAT3, Gene ID: 26229, Accession: O94766, SwissProt: O94766 |
|---|
| Catalog # | NBP1-59853 |
|---|
| Price | |
|---|
| Order / More Info | beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|