| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 17 beta-HSD1/HSD17B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 17 beta-HSD1/HSD17B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD1/HSD17B1. This antibody reacts with human. The 17 beta-HSD1/HSD17B1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human 17 beta-HSD1/HSD17B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTL |
|---|
| Other Names | 17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1 |
|---|
| Gene, Accession # | HSD17B1, Gene ID: 3292 |
|---|
| Catalog # | NBP1-84901 |
|---|
| Price | |
|---|
| Order / More Info | 17 beta-HSD1/HSD17B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|