| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 17 beta-HSD1/HSD17B1 |
|---|
| Clone | 2E5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | ascites, no preservative |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 17 beta-HSD1/HSD17B1 Antibody (2E5) from Novus Biologicals is a mouse monoclonal antibody to 17 beta-HSD1/HSD17B1. This antibody reacts with human. The 17 beta-HSD1/HSD17B1 Antibody (2E5) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | HSD17B1 (NP_000404 189 a.a. - 285 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF |
|---|
| Other Names | 17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1 |
|---|
| Gene, Accession # | HSD17B1, Gene ID: 3292, SwissProt: NP_000404 |
|---|
| Catalog # | H00003292-M03-100ug |
|---|
| Price | |
|---|
| Order / More Info | 17 beta-HSD1/HSD17B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20151319, 21740958, 27848152 |
|---|
| 产品资料 |
|
|