| 产品详情 |
| Edit |   |
| Antigenic Specificity | 17 beta-HSD14/HSD17B14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The 17 beta-HSD14/HSD17B14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD14/HSD17B14. This antibody reacts with human. The 17 beta-HSD14/HSD17B14 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the middle region of HSD17B14. Peptide sequence QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP. |
| Other Names | dehydrogenase/reductase (SDR family) member 10, Dehydrogenase/reductase SDR family member 10, DHRS1017-beta-hydroxysteroid dehydrogenase 14, EC 1.1.1.-, hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10, retinal short-chain dehydrogenase/reductase 3, Retinal short-chain dehydrogenase/reductase retSDR3, retSDR3, RETSDR3,17-beta-HSD 14, SDR3, SDR47C1, short chain dehydrogenase/reductase family 47C, member 1 |
| Gene, Accession # | HSD17B14, Gene ID: 51171, Accession: Q9BPX1, SwissProt: Q9BPX1 |
| Catalog # | NBP1-57625 |
| Price | |
| Order / More Info | 17 beta-HSD14/HSD17B14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|