| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Beta Hydroxysteroid Dehydrogenase |
|---|
| Clone | 1E8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Beta Hydroxysteroid Dehydrogenase Antibody (1E8) from Novus Biologicals is a mouse monoclonal antibody to Beta Hydroxysteroid Dehydrogenase. This antibody reacts with human. The Beta Hydroxysteroid Dehydrogenase Antibody (1E8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | HSD3B2 (NP_000189.1, 33 a.a. - 122 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT |
|---|
| Other Names | 3 beta-HSD type II, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3-beta-HSD II, delta 5-delta 4-isomerase type II, HSD3B, HSDB, HSDB3B, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase, progesterone reductase, SDR11E2, short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase |
|---|
| Gene, Accession # | HSD3B2, Gene ID: 3284, Accession: NP_000189, SwissProt: NP_000189 |
|---|
| Catalog # | H00003284-M02 |
|---|
| Price | |
|---|
| Order / More Info | Beta Hydroxysteroid Dehydrogenase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24565566 |
|---|
| 产品资料 |
|
|