| 产品详情 |
| Edit |   |
| Antigenic Specificity | CTDSP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CTDSP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTDSP1. This antibody reacts with human. The CTDSP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CTDSP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV |
| Other Names | carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 1, NIF3, NLI-IF, NLIIFEC 3.1.3.16, NLI-interacting factor 3, SCP1Nuclear LIM interactor-interacting factor 3, Small CTD phosphatase 1, Small C-terminal domain phosphatase 1 |
| Gene, Accession # | CTDSP1, Gene ID: 58190 |
| Catalog # | NBP2-57578 |
| Price | |
| Order / More Info | CTDSP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|