| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DOG1/TMEM16A |
|---|
| Clone | DOG-1.1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A/G purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 0.2 mg/ml |
|---|
| Applications | Flow Cytometry, Immunohistochemistry-Paraffin, Immunofluorescence. Hu-chromosome location: 11q13.3 Molecular weight of antigen: 114kDa Immunohistochemistry-Paraffin 0.25 - 0.5 ug/ml for 30 minutes at RT; Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10 - 20 min followed by cooling at RT for 20 minutes. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DOG1/TMEM16A Antibody (DOG-1.1) from Novus Biologicals is a mouse monoclonal antibody to DOG1/TMEM16A. This antibody reacts with human. The DOG1/TMEM16A Antibody (DOG-1.1) has been validated for the following applications: Flow Cytometry, Immunohistochemistry-Paraffin, Immunofluorescence. Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract |
|---|
| Immunogen | A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. |
|---|
| Other Names | ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A |
|---|
| Gene, Accession # | ANO1, Gene ID: 55107 |
|---|
| Catalog # | NBP2-44380-0.1mg |
|---|
| Price | |
|---|
| Order / More Info | DOG1/TMEM16A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|