| 产品详情 |
| Edit |   |
| Antigenic Specificity | DOG1/TMEM16A |
| Clone | DOG-1.1 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | Protein A/G purified |
| Size | 7 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry-Paraffin. Hu-chromosome location: 11q13.3 Molecular weight of antigen: 114kDa Immunohistochemistry-Paraffin 0.25 - 0.5 ug/ml for 30 minutes at RT; Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10 - 20 min followed by cooling at RT for 20 minutes. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DOG1/TMEM16A Antibody (DOG-1.1) - IHC-Prediluted from Novus Biologicals is a mouse monoclonal antibody to DOG1/TMEM16A. This antibody reacts with human. The DOG1/TMEM16A Antibody (DOG-1.1) - IHC-Prediluted has been validated for the following applications: Immunohistochemistry-Paraffin. Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract |
| Immunogen | A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. |
| Other Names | ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A |
| Gene, Accession # | ANO1, Gene ID: 55107 |
| Catalog # | NBP2-48151 |
| Price | |
| Order / More Info | DOG1/TMEM16A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|