| 产品详情 |
| Edit |   |
| Antigenic Specificity | DOG1/TMEM16A |
| Clone | DG1/447 + DOG-1.1 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG |
| Format | Protein A purified |
| Size | 0.1 mg |
| Concentration | 0.2 mg/ml |
| Applications | Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Human Chromosome Location: 11q13.3 Immunohistochemistry (Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) from Novus Biologicals is a mouse monoclonal antibody to DOG1/TMEM16A. This antibody reacts with human. The DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) has been validated for the following applications: Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract |
| Immunogen | Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1) |
| Other Names | ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A |
| Gene, Accession # | ANO1, Gene ID: 55107, Accession: Q5XXA6, SwissProt: Q5XXA6 |
| Catalog # | NBP2-34285-0.1mg |
| Price | |
| Order / More Info | DOG1/TMEM16A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|