| 产品详情 |
| Edit |   |
| Antigenic Specificity | DOG1/TMEM16A |
| Clone | DOG-1.1 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | Alexa Fluor 350 conjugate |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Optimal dilution of this antibody should be experimentally determined. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DOG1/TMEM16A Antibody (DOG-1.1) [Alexa Fluor® 350] from Novus Biologicals is a mouse monoclonal antibody to DOG1/TMEM16A. This antibody reacts with human. The DOG1/TMEM16A Antibody (DOG-1.1) [Alexa Fluor® 350] has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract |
| Immunogen | A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. |
| Other Names | ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A |
| Gene, Accession # | ANO1, Gene ID: 55107 |
| Catalog # | NBP2-34606AF350 |
| Price | |
| Order / More Info | DOG1/TMEM16A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|