| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DOG1/TMEM16A |
|---|
| Clone | DG1/447 + DOG-1.1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG |
|---|
| Format | PE-Cy5.5 conjugate |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Flow Cytometry. Optimal dilution of this antibody should be experimentally determined. For optimal results using our Tandem dyes, please avoid prolonged exposure to light or extreme temperature fluctuations. These can lead to irreversible degradation or decoupling. When staining intracellular targets, specific attention to the fixation and permeabilization steps in your flow protocol may be required. Please contact our technical support team at technical@novusbio.com if you have any questions. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [PE/Cy5.5] from Novus Biologicals is a mouse monoclonal antibody to DOG1/TMEM16A. This antibody reacts with human. The DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [PE/Cy5.5] has been validated for the following applications: Flow Cytometry. Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract |
|---|
| Immunogen | Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1) |
|---|
| Other Names | ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A |
|---|
| Gene, Accession # | ANO1, Gene ID: 55107 |
|---|
| Catalog # | NBP2-34604PECY55 |
|---|
| Price | |
|---|
| Order / More Info | DOG1/TMEM16A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|