| Edit |   |
|---|
| Antigenic Specificity | Necdin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Necdin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Necdin. This antibody reacts with human. The Necdin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NDN(necdin homolog (mouse)) The peptide sequence was selected from the middle region of NDN. Peptide sequence VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF. |
|---|
| Other Names | HsT16328, necdin, necdin (mouse) homolog, necdin homolog (mouse), PWCR |
|---|
| Gene, Accession # | NDN, Gene ID: 4692, Accession: Q99608, SwissProt: Q99608 |
|---|
| Catalog # | NBP1-58244 |
|---|
| Price | |
|---|
| Order / More Info | Necdin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|