| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cdx1 |
|---|
| Clone | 2D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cdx1 Antibody (2D8) from Novus Biologicals is a mouse monoclonal antibody to Cdx1. This antibody reacts with human. The Cdx1 Antibody (2D8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | CDX1 (NP_001795 126 a.a. - 215 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK |
|---|
| Other Names | caudal type homeo box transcription factor 1, caudal type homeobox 1, caudal type homeobox transcription factor 1, Caudal-type homeobox protein 1, caudal-type homeobox protein CDX1, homeobox protein CDX-1, MGC116915 |
|---|
| Gene, Accession # | CDX1, Gene ID: 1044, Accession: NP_001795, SwissProt: NP_001795 |
|---|
| Catalog # | H00001044-M01 |
|---|
| Price | |
|---|
| Order / More Info | Cdx1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22076569 |
|---|
| 产品资料 |
|
|