| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Siglec-5/CD170 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Siglec-5/CD170 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Siglec-5/CD170. This antibody reacts with human. The Siglec-5/CD170 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Siglec-5/CD170 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK |
|---|
| Other Names | CD170, CD170 antigen, CD33 antigen-like 2, CD33L2OB binding protein-2, OB-BP2OB-binding protein 2, OBBP2sialic acid-binding Ig-like lectin 5, Obesity-binding protein 2, sialic acid binding Ig-like lectin 5, sialic acid-binding immunoglobulin-like lectin 5, SIGLEC-5 |
|---|
| Gene, Accession # | SIGLEC5, Gene ID: 8778 |
|---|
| Catalog # | NBP1-91149 |
|---|
| Price | |
|---|
| Order / More Info | Siglec-5/CD170 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|