| Edit |   |
| Antigenic Specificity | COG3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COG3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COG3. This antibody reacts with human. The COG3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT |
| Other Names | COG complex subunit 3, component of oligomeric golgi complex 3p94, SEC34conserved oligomeric Golgi complex subunit 3, tethering factor SEC34, Vesicle-docking protein SEC34 homolog |
| Gene, Accession # | COG3, Gene ID: 83548 |
| Catalog # | NBP2-68711 |
| Price | |
| Order / More Info | COG3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |