| 产品详情 |
| Edit |   |
| Antigenic Specificity | Peroxiredoxin 5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Peroxiredoxin 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peroxiredoxin 5. This antibody reacts with human. The Peroxiredoxin 5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Peroxiredoxin 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGN |
| Other Names | ACR1Peroxisomal antioxidant enzyme, Alu corepressor 1, Alu co-repressor 1, Antioxidant enzyme B166, AOEB166Peroxiredoxin V, B166, EC 1.11.1.15, Liver tissue 2D-page spot 71B, MGC117264, MGC142283, MGC142285, peroxiredoxin 5, peroxiredoxin-5, mitochondrial, PLPThioredoxin peroxidase PMP20, PMP20, PRDX6, prx-V, PRXV, SBBI10, Thioredoxin reductase, TPx type VI |
| Gene, Accession # | PRDX5, Gene ID: 25824, Accession: P30044, SwissProt: P30044 |
| Catalog # | NBP2-38370 |
| Price | |
| Order / More Info | Peroxiredoxin 5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|