| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TLX/NR2E1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TLX/NR2E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TLX/NR2E1. This antibody reacts with human. The TLX/NR2E1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TLX/NR2E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSY |
|---|
| Other Names | hTll, nuclear receptor subfamily 2, group E, member 1, Nuclear receptor TLX, Protein tailless homolog, tailes-related receptor, tailless homolog, Tll, TLXnuclear receptor subfamily 2 group E member 1, XTLL |
|---|
| Gene, Accession # | NR2E1, Gene ID: 7101, Accession: Q9Y466, SwissProt: Q9Y466 |
|---|
| Catalog # | NBP2-38764 |
|---|
| Price | |
|---|
| Order / More Info | TLX/NR2E1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|