| Edit |   |
| Antigenic Specificity | NOR1/OSCP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NOR1/OSCP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOR1/OSCP1. This antibody reacts with human. The NOR1/OSCP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C1orf102 (organic solute carrier partner 1) The peptide sequence was selected from the N terminal of C1orf102)(50ug). Peptide sequence ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ. |
| Other Names | C1orf102, NOR1, OSCP1 organic solute carrier partner 1 |
| Gene, Accession # | OSCP1, Gene ID: 127700, Accession: A6NIN9, SwissProt: A6NIN9 |
| Catalog # | NBP1-57771-20ul |
| Price | |
| Order / More Info | NOR1/OSCP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |