| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Norrin/NDP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Norrin/NDP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Norrin/NDP. This antibody reacts with human. The Norrin/NDP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to NDP(Norrie disease (pseudoglioma)) The peptide sequence was selected from the middle region of NDP. Peptide sequence DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV. |
|---|
| Other Names | EVR2, exudative vitreoretinopathy 2 (X-linked), FEVR, ND, Norrie disease (pseudoglioma), Norrie disease protein, norrin, X-linked exudative vitreoretinopathy 2 protein |
|---|
| Gene, Accession # | NDP, Gene ID: 4693, Accession: Q00604, SwissProt: Q00604 |
|---|
| Catalog # | NBP1-59305 |
|---|
| Price | |
|---|
| Order / More Info | Norrin/NDP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29284024 |
|---|
| 产品资料 |
|
|