| 产品详情 |
| Edit |   |
| Antigenic Specificity | NOS1AP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NOS1AP Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOS1AP. This antibody reacts with human. The NOS1AP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NOS1AP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV |
| Other Names | 6330408P19Rik, CAPONMGC138500, carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON), ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain, nitric oxide synthase 1 (neuronal) adaptor protein, Nitric oxide synthase 1 adaptor protein |
| Gene, Accession # | NOS1AP, Gene ID: 9722, Accession: O75052, SwissProt: O75052 |
| Catalog # | NBP2-38758 |
| Price | |
| Order / More Info | NOS1AP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|