| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCTAIRE3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | |
|---|
| Description | The PCTAIRE3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCTAIRE3. This antibody reacts with human. The PCTAIRE3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCTAIRE3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQ |
|---|
| Other Names | Cell division protein kinase 18, cyclin-dependent kinase 18, EC 2.7.11, EC 2.7.11.22, PCTAIRE, PCTAIRE3, PCTAIRE-motif protein kinase 3, PCTK3PCTAIRE protein kinase 3, Serine/threonine-protein kinase PCTAIRE-3 |
|---|
| Gene, Accession # | CDK18, Gene ID: 5129 |
|---|
| Catalog # | NBP1-92249 |
|---|
| Price | |
|---|
| Order / More Info | PCTAIRE3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|
