| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCYT1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCYT1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCYT1A. This antibody reacts with human. The PCYT1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCYT1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVR |
|---|
| Other Names | CCT A, CCT-alpha, choline-phosphate cytidylyltransferase A, CT, CT A, CTA, CTP:phosphocholine cytidylyltransferase A, CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform, EC 2.7.7, EC 2.7.7.15, PCYT1CCTA, phosphate cytidylyltransferase 1, choline, alpha, Phosphorylcholine transferase A |
|---|
| Gene, Accession # | PCYT1A, Gene ID: 5130 |
|---|
| Catalog # | NBP1-84366 |
|---|
| Price | |
|---|
| Order / More Info | PCYT1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|