| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCYT1A |
|---|
| Clone | 6E6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCYT1A Antibody (6E6) from Novus Biologicals is a mouse monoclonal antibody to PCYT1A. This antibody reacts with human, rat. The PCYT1A Antibody (6E6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | PCYT1A (NP_005008, 2 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS |
|---|
| Other Names | CCT A, CCT-alpha, choline-phosphate cytidylyltransferase A, CT, CT A, CTA, CTP:phosphocholine cytidylyltransferase A, CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform, EC 2.7.7, EC 2.7.7.15, PCYT1CCTA, phosphate cytidylyltransferase 1, choline, alpha, Phosphorylcholine transferase A |
|---|
| Gene, Accession # | PCYT1A, Gene ID: 5130, Accession: NP_005008, SwissProt: NP_005008 |
|---|
| Catalog # | H00005130-M02 |
|---|
| Price | |
|---|
| Order / More Info | PCYT1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|