| Edit |   |
| Antigenic Specificity | C3orf49 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C3orf49 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C3orf49. This antibody reacts with human. The C3orf49 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C3orf49 (chromosome 3 open reading frame 49) The peptide sequence was selected from the middle region of C3orf49. Peptide sequence IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH. |
| Other Names | chromosome 3 open reading frame 49, MGC17310 |
| Gene, Accession # | C3ORF49, Gene ID: 132200 |
| Catalog # | NBP1-70472 |
| Price | |
| Order / More Info | C3orf49 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |