| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytosolic Sulfotransferase 1C4/SULT1C4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytosolic Sulfotransferase 1C4/SULT1C4. This antibody reacts with human. The Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SULT1C4(sulfotransferase family, cytosolic, 1C, member 4) The peptide sequence was selected from the middle region of SULT1C4. Peptide sequence HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK. |
|---|
| Other Names | EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2 |
|---|
| Gene, Accession # | SULT1C4, Gene ID: 27233, Accession: O75897, SwissProt: O75897 |
|---|
| Catalog # | NBP1-52893-20ul |
|---|
| Price | |
|---|
| Order / More Info | Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|