| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytosolic Sulfotransferase 1E1/SULT1E1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 22414680). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytosolic Sulfotransferase 1E1/SULT1E1. This antibody reacts with human. The Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cytosolic Sulfotransferase 1E1/SULT1E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEI |
|---|
| Other Names | EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4 |
|---|
| Gene, Accession # | SULT1E1, Gene ID: 6783 |
|---|
| Catalog # | NBP1-84786 |
|---|
| Price | |
|---|
| Order / More Info | Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22414680 |
|---|
| 产品资料 |
|
|