| Edit |   |
|---|
| Antigenic Specificity | ANKRD13B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD13B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD13B. This antibody reacts with human. The ANKRD13B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ANKRD13B. Peptide sequence HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ. |
|---|
| Other Names | ankyrin repeat domain 13B, FLJ25555 |
|---|
| Gene, Accession # | ANKRD13B, Gene ID: 124930, Accession: NP_689558, SwissProt: NP_689558 |
|---|
| Catalog # | NBP1-91433 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD13B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|