| Edit |   |
|---|
| Antigenic Specificity | ANKRD30B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD30B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD30B. This antibody reacts with human. The ANKRD30B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ANKRD30B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KASTNVDVSSVEPIFSLFGTRTIENSQCTKVEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPS |
|---|
| Other Names | Ankyrin Repeat Domain-Containing Protein 30B, Breast Cancer Antigen NY-BR-1.1, NY-BR-1.1, Serologically Defined Breast Cancer Antigen NY-BR-1.1 |
|---|
| Gene, Accession # | ANKRD30B, Gene ID: 374860 |
|---|
| Catalog # | NBP2-32544 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD30B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|