| Edit |   |
|---|
| Antigenic Specificity | ANKRD34B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD34B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD34B. This antibody reacts with human. The ANKRD34B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ANKRD34B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR |
|---|
| Other Names | ankyrin repeat domain 34B, DP58 |
|---|
| Gene, Accession # | ANKRD34B, Gene ID: 340120, Accession: A5PLL1, SwissProt: A5PLL1 |
|---|
| Catalog # | NBP1-90487 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD34B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|