| Edit |   |
| Antigenic Specificity | ANKRD13D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANKRD13D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD13D. This antibody reacts with mouse. The ANKRD13D Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human Ankrd13dThe immunogen for this antibody is Ankrd13d. Peptide sequence RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI. |
| Other Names | ankyrin repeat domain 13 family, member D, ankyrin repeat domain-containing protein 13D, MGC50828 |
| Gene, Accession # | ANKRD13D, Gene ID: 338692, Accession: NP_080996 |
| Catalog # | NBP1-79611 |
| Price | |
| Order / More Info | ANKRD13D Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |