| Edit |   |
|---|
| Antigenic Specificity | ANKS1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKS1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKS1A. This antibody reacts with human. The ANKS1A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ANKS1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETKKVVLVDGKTKDHRRSSSSRSQDSAEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLCTAGQSHPDGSPQQGACHKASMQLEETGVHAPG |
|---|
| Other Names | ANKS1ankyrin repeat and SAM domain-containing protein 1A, ankyrin repeat and SAM domain containing 1, ankyrin repeat and sterile alpha motif domain containing 1, ankyrin repeat and sterile alpha motif domain containing 1A, KIAA0229MGC42354, ODIN |
|---|
| Gene, Accession # | ANKS1A, Gene ID: 23294 |
|---|
| Catalog # | NBP1-89078 |
|---|
| Price | |
|---|
| Order / More Info | ANKS1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|