| Edit |   |
|---|
| Antigenic Specificity | ANKS4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKS4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKS4B. This antibody reacts with human. The ANKS4B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ANKS4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP |
|---|
| Other Names | ankyrin repeat and sterile alpha motif domain containing 4B, FLJ38819harmonin-interacting ankyrin-repeat containing protein, Harmonin-interacting ankyrin repeat-containing protein, Harp, HARPankyrin repeat and SAM domain-containing protein 4B, MGC133380, MGC133381 |
|---|
| Gene, Accession # | ANKS4B, Gene ID: 257629, Accession: Q8N8V4, SwissProt: Q8N8V4 |
|---|
| Catalog # | NBP1-91672 |
|---|
| Price | |
|---|
| Order / More Info | ANKS4B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|