| Edit |   |
| Antigenic Specificity | ISLR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ISLR Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISLR. This antibody reacts with human. The ISLR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHG KAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG |
| Other Names | HsT17563, immunoglobulin superfamily containing leucine-rich repeat, immunoglobulin superfamily containing leucine-rich repeat protein, MGC102816 |
| Gene, Accession # | ISLR, Gene ID: 3671 |
| Catalog # | NBP2-14131-25ul |
| Price | |
| Order / More Info | ISLR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |