| Edit |   |
|---|
| Antigenic Specificity | ISLR-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ISLR-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISLR-2. This antibody reacts with human. The ISLR-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ISLR2. Peptide sequence PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA. |
|---|
| Other Names | immunoglobulin superfamily containing leucine-rich repeat 2, KIAA1465, leucine-rich repeat domain and immunoglobulin domain-containing axon extension protein, LINX, UNQ1885/PRO4329 |
|---|
| Gene, Accession # | ISLR2, Gene ID: 57611, Accession: NP_065902, SwissProt: NP_065902 |
|---|
| Catalog # | NBP1-91341-20ul |
|---|
| Price | |
|---|
| Order / More Info | ISLR-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|