| 产品详情 |
| Edit |   |
| Antigenic Specificity | ISM2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ISM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISM2. This antibody reacts with human. The ISM2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ISM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVTIKVVEDPQAEVSIDLLAEPSNPPPQDTLSWLPALWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEDIEGEDQE |
| Other Names | DKFZp686E0215, FLJ32147, isthmin 2 homolog (zebrafish), PSEC0137, thrombospondin and AMOP domain-containing isthmin-like protein 1, thrombospondin type-1 domain-containing protein 3, thrombospondin, type I domain-containing 3, THSD3, type I, domain containing 3 |
| Gene, Accession # | ISM2, Gene ID: 145501 |
| Catalog # | NBP1-82002 |
| Price | |
| Order / More Info | ISM2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|