| Edit |   |
|---|
| Antigenic Specificity | PRR5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRR5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRR5. This antibody reacts with human. The PRR5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human PRR5. Peptide sequence NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT. |
|---|
| Other Names | FLJ20185, FLJ20185k, proline rich 5 (renal), protein observed with Rictor-1 |
|---|
| Gene, Accession # | PRR5, Gene ID: 55615, Accession: NP_056181, SwissProt: NP_056181 |
|---|
| Catalog # | NBP1-91481-20ul |
|---|
| Price | |
|---|
| Order / More Info | PRR5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|