| Edit |   |
| Antigenic Specificity | PRR5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRR5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRR5. This antibody reacts with human. The PRR5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human PRR5. Peptide sequence GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS. |
| Other Names | FLJ20185, FLJ20185k, proline rich 5 (renal), protein observed with Rictor-1 |
| Gene, Accession # | PRR5, Gene ID: 55615, Accession: NP_056181, SwissProt: NP_056181 |
| Catalog # | NBP1-91482-20ul |
| Price | |
| Order / More Info | PRR5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |